Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479

  1. Avatar for Pawel Tluscik 81. Pawel Tluscik Lv 1 2 pts. 9,025
  2. Avatar for rinze 82. rinze Lv 1 2 pts. 9,016
  3. Avatar for AlkiP0Ps 83. AlkiP0Ps Lv 1 2 pts. 9,007
  4. Avatar for Trajan464 84. Trajan464 Lv 1 2 pts. 8,987
  5. Avatar for Savas 85. Savas Lv 1 2 pts. 8,972
  6. Avatar for Silvercraft 86. Silvercraft Lv 1 2 pts. 8,970
  7. Avatar for wosser1 87. wosser1 Lv 1 2 pts. 8,967
  8. Avatar for Todd6485577 88. Todd6485577 Lv 1 2 pts. 8,928
  9. Avatar for NotJim99 89. NotJim99 Lv 1 2 pts. 8,927
  10. Avatar for Czim 90. Czim Lv 1 1 pt. 8,916

Comments