Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,131
  2. Avatar for g_b 2. g_b Lv 1 97 pts. 10,127
  3. Avatar for Phyx 3. Phyx Lv 1 94 pts. 10,117
  4. Avatar for ichwilldiesennamen 4. ichwilldiesennamen Lv 1 91 pts. 10,109
  5. Avatar for akaaka 5. akaaka Lv 1 88 pts. 10,107
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 85 pts. 10,107
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 82 pts. 10,099
  8. Avatar for mirp 8. mirp Lv 1 79 pts. 10,093
  9. Avatar for grogar7 9. grogar7 Lv 1 76 pts. 10,071
  10. Avatar for robgee 10. robgee Lv 1 74 pts. 10,062

Comments