1970: Revisiting Puzzle 59: TCR Binding Protein
Closed since almost 5 years ago
Novice Overall PredictionSummary
- Created
- March 18, 2021
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT