Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for toshiue
    1. toshiue Lv 1
    100 pts. 10,136
  2. Avatar for mirp 2. mirp Lv 1 73 pts. 10,135
  3. Avatar for Galaxie 3. Galaxie Lv 1 52 pts. 10,134
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 36 pts. 10,134
  5. Avatar for silent gene 5. silent gene Lv 1 24 pts. 10,124
  6. Avatar for alcor29 6. alcor29 Lv 1 16 pts. 10,117
  7. Avatar for ichwilldiesennamen 7. ichwilldiesennamen Lv 1 10 pts. 10,109
  8. Avatar for kyoota 8. kyoota Lv 1 6 pts. 10,073
  9. Avatar for Norrjane 9. Norrjane Lv 1 4 pts. 10,069
  10. Avatar for argyrw 10. argyrw Lv 1 2 pts. 10,068

Comments