Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Window Group 15. Window Group 1 pt. 7,774
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,131
  2. Avatar for g_b 2. g_b Lv 1 97 pts. 10,127
  3. Avatar for Phyx 3. Phyx Lv 1 94 pts. 10,117
  4. Avatar for ichwilldiesennamen 4. ichwilldiesennamen Lv 1 91 pts. 10,109
  5. Avatar for akaaka 5. akaaka Lv 1 88 pts. 10,107
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 85 pts. 10,107
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 82 pts. 10,099
  8. Avatar for mirp 8. mirp Lv 1 79 pts. 10,093
  9. Avatar for grogar7 9. grogar7 Lv 1 76 pts. 10,071
  10. Avatar for robgee 10. robgee Lv 1 74 pts. 10,062

Comments