Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656

  1. Avatar for Primrose 121. Primrose Lv 1 1 pt. 8,549
  2. Avatar for DScott 122. DScott Lv 1 1 pt. 8,547
  3. Avatar for evelpinkybrain 123. evelpinkybrain Lv 1 1 pt. 8,510
  4. Avatar for little scientist 124. little scientist Lv 1 1 pt. 8,496
  5. Avatar for helcboom 125. helcboom Lv 1 1 pt. 8,490
  6. Avatar for artsyambie6 126. artsyambie6 Lv 1 1 pt. 8,483
  7. Avatar for Swapper242 127. Swapper242 Lv 1 1 pt. 8,482
  8. Avatar for illex 128. illex Lv 1 1 pt. 8,482
  9. Avatar for rejuvenatio 129. rejuvenatio Lv 1 1 pt. 8,374
  10. Avatar for deathbat_87 130. deathbat_87 Lv 1 1 pt. 8,371

Comments