Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656

  1. Avatar for Fields 131. Fields Lv 1 1 pt. 8,281
  2. Avatar for ssrinivasan1 132. ssrinivasan1 Lv 1 1 pt. 8,025
  3. Avatar for KylarRen 133. KylarRen Lv 1 1 pt. 7,987
  4. Avatar for zannipietro 134. zannipietro Lv 1 1 pt. 7,976
  5. Avatar for krg0029 135. krg0029 Lv 1 1 pt. 7,911
  6. Avatar for harvardman 136. harvardman Lv 1 1 pt. 7,855
  7. Avatar for jflat06 137. jflat06 Lv 1 1 pt. 7,774
  8. Avatar for SuperSallyGUO 138. SuperSallyGUO Lv 1 1 pt. 7,721
  9. Avatar for 2339140839 139. 2339140839 Lv 1 1 pt. 6,739
  10. Avatar for jasmeeng1 140. jasmeeng1 Lv 1 1 pt. 3,473

Comments