Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656

  1. Avatar for SileNTViP 11. SileNTViP Lv 1 71 pts. 10,059
  2. Avatar for PieThrower 12. PieThrower Lv 1 68 pts. 10,053
  3. Avatar for Aubade01 13. Aubade01 Lv 1 66 pts. 10,047
  4. Avatar for nicobul 14. nicobul Lv 1 64 pts. 10,016
  5. Avatar for LociOiling 15. LociOiling Lv 1 61 pts. 10,010
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 59 pts. 10,008
  7. Avatar for silent gene 17. silent gene Lv 1 57 pts. 10,001
  8. Avatar for Norrjane 18. Norrjane Lv 1 55 pts. 9,999
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 53 pts. 9,993
  10. Avatar for MicElephant 20. MicElephant Lv 1 51 pts. 9,963

Comments