Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656

  1. Avatar for jobo0502 21. jobo0502 Lv 1 49 pts. 9,962
  2. Avatar for guineapig 22. guineapig Lv 1 47 pts. 9,958
  3. Avatar for frood66 23. frood66 Lv 1 45 pts. 9,955
  4. Avatar for pauldunn 24. pauldunn Lv 1 43 pts. 9,951
  5. Avatar for fiendish_ghoul 25. fiendish_ghoul Lv 1 42 pts. 9,940
  6. Avatar for borattt 26. borattt Lv 1 40 pts. 9,906
  7. Avatar for Blipperman 27. Blipperman Lv 1 39 pts. 9,888
  8. Avatar for NeLikomSheet 28. NeLikomSheet Lv 1 37 pts. 9,879
  9. Avatar for aznarog 29. aznarog Lv 1 36 pts. 9,866
  10. Avatar for Lotus23 30. Lotus23 Lv 1 34 pts. 9,864

Comments