Placeholder image of a protein
Icon representing a puzzle

1972: CMG2 with Density

Closed since almost 5 years ago

Advanced Overall Prediction Electron Density

Summary

Created
March 26, 2021
Expires
Max points
100
Description

Fold this CMG2 protein into the electron density map! This protein is a domain of the human capillary morphogenesis protein 2 (CMG2). The CMG2 protein normally associates with other proteins in connective tissue, and is thought to be important for the formation of new blood vessels. But CMG2 is also targeted by the anthrax toxin, and has been implicated in certain types of cancer. The protein in this puzzle is a variant of CMG2 that researchers are studying to better understand its structure and function. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein. Help us determine the structure of this CMG2 variant by folding it in the electron density!



Sequence:


SARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 17,522
  2. Avatar for Marvin's bunch 2. Marvin's bunch 70 pts. 14,860
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 14,127
  4. Avatar for Contenders 4. Contenders 30 pts. 14,094
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 13,773
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 13,503
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 7 pts. 13,335
  8. Avatar for Gargleblasters 8. Gargleblasters 4 pts. 13,118
  9. Avatar for Team China 9. Team China 2 pts. 12,300
  10. Avatar for Olsztynek 10. Olsztynek 1 pt. 11,561
  1. Avatar for Karlheinz 101. Karlheinz Lv 1 1 pt. 7,546
  2. Avatar for Swapper242 102. Swapper242 Lv 1 1 pt. 7,458
  3. Avatar for chrisb41 103. chrisb41 Lv 1 1 pt. 7,418
  4. Avatar for sgeldhof 104. sgeldhof Lv 1 1 pt. 5,703
  5. Avatar for Susume 105. Susume Lv 1 1 pt. 5,149
  6. Avatar for ronj0176 106. ronj0176 Lv 1 1 pt. 5,049
  7. Avatar for Diegomodolo 107. Diegomodolo Lv 1 1 pt. 0
  8. Avatar for Deleted player 108. Deleted player pts. 0
  9. Avatar for NPrincipi 109. NPrincipi Lv 1 1 pt. 0
  10. Avatar for alyssa_d_V2.0 110. alyssa_d_V2.0 Lv 1 1 pt. 0

Comments