Foldit

1972: CMG2 with Density

Closed since almost 5 years ago

Advanced Overall Prediction Electron Density

Summary

Created: March 26, 2021
Expires: April 01, 2021 at 18:00 UTC
Max points: 100

Description

Fold this CMG2 protein into the electron density map! This protein is a domain of the human capillary morphogenesis protein 2 (CMG2). The CMG2 protein normally associates with other proteins in connective tissue, and is thought to be important for the formation of new blood vessels. But CMG2 is also targeted by the anthrax toxin, and has been implicated in certain types of cancer. The protein in this puzzle is a variant of CMG2 that researchers are studying to better understand its structure and function. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein. Help us determine the structure of this CMG2 variant by folding it in the electron density!

Sequence:

SARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQS