Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 2 pts. 11,501
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,196
  3. Avatar for Australia 13. Australia 1 pt. 10,981
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 10,674
  5. Avatar for Czech National Team 15. Czech National Team 1 pt. 10,550
  6. Avatar for Russian team 16. Russian team 1 pt. 10,414
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,850
  8. Avatar for Window Group 18. Window Group 1 pt. 6,494
  9. Avatar for bmd 19. bmd 1 pt. 4,514
  1. Avatar for pauldunn 31. pauldunn Lv 1 31 pts. 12,002
  2. Avatar for TurtleByte 32. TurtleByte Lv 1 30 pts. 11,988
  3. Avatar for maithra 33. maithra Lv 1 29 pts. 11,979
  4. Avatar for ucad 34. ucad Lv 1 27 pts. 11,978
  5. Avatar for borattt 35. borattt Lv 1 26 pts. 11,974
  6. Avatar for vuvuvu 36. vuvuvu Lv 1 25 pts. 11,962
  7. Avatar for jausmh 37. jausmh Lv 1 24 pts. 11,953
  8. Avatar for Skippysk8s 38. Skippysk8s Lv 1 23 pts. 11,930
  9. Avatar for blazegeek 39. blazegeek Lv 1 22 pts. 11,911
  10. Avatar for manu8170 40. manu8170 Lv 1 21 pts. 11,898

Comments