Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,819
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 12,616
  3. Avatar for Go Science 3. Go Science 56 pts. 12,455
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 12,450
  5. Avatar for Contenders 5. Contenders 29 pts. 12,422
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 12,400
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,090
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,962
  9. Avatar for Team China 9. Team China 6 pts. 11,785
  10. Avatar for Void Crushers 10. Void Crushers 4 pts. 11,774

  1. Avatar for Primrose 101. Primrose Lv 1 1 pt. 11,021
  2. Avatar for Algieba 102. Algieba Lv 1 1 pt. 11,020
  3. Avatar for AlkiP0Ps 103. AlkiP0Ps Lv 1 1 pt. 10,981
  4. Avatar for multaq 104. multaq Lv 1 1 pt. 10,978
  5. Avatar for Hellcat6 105. Hellcat6 Lv 1 1 pt. 10,922
  6. Avatar for HurryPeng 106. HurryPeng Lv 1 1 pt. 10,912
  7. Avatar for Swapper242 107. Swapper242 Lv 1 1 pt. 10,906
  8. Avatar for marsfan 108. marsfan Lv 1 1 pt. 10,886
  9. Avatar for Tarikgalich 109. Tarikgalich Lv 1 1 pt. 10,868
  10. Avatar for Creat 110. Creat Lv 1 1 pt. 10,867

Comments