Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,819
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 12,616
  3. Avatar for Go Science 3. Go Science 56 pts. 12,455
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 12,450
  5. Avatar for Contenders 5. Contenders 29 pts. 12,422
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 12,400
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,090
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,962
  9. Avatar for Team China 9. Team China 6 pts. 11,785
  10. Avatar for Void Crushers 10. Void Crushers 4 pts. 11,774

  1. Avatar for jflat06 131. jflat06 Lv 1 1 pt. 6,494
  2. Avatar for jrehfeldt 132. jrehfeldt Lv 1 1 pt. 5,749
  3. Avatar for bmd_2021_CRHU 133. bmd_2021_CRHU Lv 1 1 pt. 5,421
  4. Avatar for Laddu 134. Laddu Lv 1 1 pt. 4,591
  5. Avatar for ManVsYard 135. ManVsYard Lv 1 1 pt. 4,514
  6. Avatar for bmd_21_AMGE 136. bmd_21_AMGE Lv 1 1 pt. 4,514
  7. Avatar for bmd_21_AZR 137. bmd_21_AZR Lv 1 1 pt. 4,514
  8. Avatar for xyc 138. xyc Lv 1 1 pt. 4,514
  9. Avatar for toshiue 139. toshiue Lv 1 1 pt. 4,514
  10. Avatar for caohyang 140. caohyang Lv 1 1 pt. 4,514

Comments