Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,819
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 12,616
  3. Avatar for Go Science 3. Go Science 56 pts. 12,455
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 12,450
  5. Avatar for Contenders 5. Contenders 29 pts. 12,422
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 12,400
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,090
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,962
  9. Avatar for Team China 9. Team China 6 pts. 11,785
  10. Avatar for Void Crushers 10. Void Crushers 4 pts. 11,774

  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 70 pts. 12,347
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 68 pts. 12,325
  3. Avatar for Anfinsen_slept_here 13. Anfinsen_slept_here Lv 1 65 pts. 12,314
  4. Avatar for grogar7 14. grogar7 Lv 1 63 pts. 12,257
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 60 pts. 12,230
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 58 pts. 12,197
  7. Avatar for g_b 17. g_b Lv 1 56 pts. 12,186
  8. Avatar for fiendish_ghoul 18. fiendish_ghoul Lv 1 54 pts. 12,159
  9. Avatar for nicobul 19. nicobul Lv 1 52 pts. 12,125
  10. Avatar for ProfVince 20. ProfVince Lv 1 50 pts. 12,113

Comments