Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,819
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 12,616
  3. Avatar for Go Science 3. Go Science 56 pts. 12,455
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 12,450
  5. Avatar for Contenders 5. Contenders 29 pts. 12,422
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 12,400
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,090
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,962
  9. Avatar for Team China 9. Team China 6 pts. 11,785
  10. Avatar for Void Crushers 10. Void Crushers 4 pts. 11,774

  1. Avatar for dcrwheeler 21. dcrwheeler Lv 1 48 pts. 12,112
  2. Avatar for johnmitch 22. johnmitch Lv 1 46 pts. 12,091
  3. Avatar for PeterDav 23. PeterDav Lv 1 44 pts. 12,087
  4. Avatar for drumpeter18yrs9yrs 24. drumpeter18yrs9yrs Lv 1 42 pts. 12,085
  5. Avatar for MicElephant 25. MicElephant Lv 1 40 pts. 12,082
  6. Avatar for NeLikomSheet 26. NeLikomSheet Lv 1 39 pts. 12,080
  7. Avatar for OWM3 27. OWM3 Lv 1 37 pts. 12,079
  8. Avatar for fishercat 28. fishercat Lv 1 36 pts. 12,078
  9. Avatar for hansvandenhof 29. hansvandenhof Lv 1 34 pts. 12,050
  10. Avatar for equilibria 30. equilibria Lv 1 33 pts. 12,026

Comments