Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since about 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,819
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 12,616
  3. Avatar for Go Science 3. Go Science 56 pts. 12,455
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 12,450
  5. Avatar for Contenders 5. Contenders 29 pts. 12,422
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 12,400
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,090
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,962
  9. Avatar for Team China 9. Team China 6 pts. 11,785
  10. Avatar for Void Crushers 10. Void Crushers 4 pts. 11,774

  1. Avatar for infjamc 41. infjamc Lv 1 20 pts. 11,855
  2. Avatar for Deleted player 42. Deleted player pts. 11,832
  3. Avatar for guineapig 43. guineapig Lv 1 18 pts. 11,814
  4. Avatar for akaaka 44. akaaka Lv 1 17 pts. 11,803
  5. Avatar for REDing 45. REDing Lv 1 16 pts. 11,785
  6. Avatar for spdenne 46. spdenne Lv 1 16 pts. 11,774
  7. Avatar for xythus 47. xythus Lv 1 15 pts. 11,759
  8. Avatar for Evica 48. Evica Lv 1 14 pts. 11,753
  9. Avatar for sciencewalker 49. sciencewalker Lv 1 13 pts. 11,736
  10. Avatar for hada 50. hada Lv 1 13 pts. 11,712

Comments