Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,819
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 12,616
  3. Avatar for Go Science 3. Go Science 56 pts. 12,455
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 12,450
  5. Avatar for Contenders 5. Contenders 29 pts. 12,422
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 12,400
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,090
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,962
  9. Avatar for Team China 9. Team China 6 pts. 11,785
  10. Avatar for Void Crushers 10. Void Crushers 4 pts. 11,774

  1. Avatar for roman madala 61. roman madala Lv 1 7 pts. 11,591
  2. Avatar for cjddig 62. cjddig Lv 1 7 pts. 11,563
  3. Avatar for Oransche 63. Oransche Lv 1 6 pts. 11,546
  4. Avatar for tracybutt 64. tracybutt Lv 1 6 pts. 11,543
  5. Avatar for ziyu zhou 65. ziyu zhou Lv 1 6 pts. 11,539
  6. Avatar for pascal ochem 66. pascal ochem Lv 1 5 pts. 11,508
  7. Avatar for Wiz kid 67. Wiz kid Lv 1 5 pts. 11,503
  8. Avatar for Pawel Tluscik 68. Pawel Tluscik Lv 1 5 pts. 11,501
  9. Avatar for fpc 69. fpc Lv 1 4 pts. 11,468
  10. Avatar for abiogenesis 70. abiogenesis Lv 1 4 pts. 11,445

Comments