Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,819
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 12,616
  3. Avatar for Go Science 3. Go Science 56 pts. 12,455
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 12,450
  5. Avatar for Contenders 5. Contenders 29 pts. 12,422
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 12,400
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,090
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,962
  9. Avatar for Team China 9. Team China 6 pts. 11,785
  10. Avatar for Void Crushers 10. Void Crushers 4 pts. 11,774

  1. Avatar for argyrw 71. argyrw Lv 1 4 pts. 11,433
  2. Avatar for Todd6485577 72. Todd6485577 Lv 1 4 pts. 11,430
  3. Avatar for kitsoune 73. kitsoune Lv 1 4 pts. 11,429
  4. Avatar for donuts554 74. donuts554 Lv 1 3 pts. 11,401
  5. Avatar for BarrySampson 75. BarrySampson Lv 1 3 pts. 11,396
  6. Avatar for Guillaume628 76. Guillaume628 Lv 1 3 pts. 11,389
  7. Avatar for HuubR 77. HuubR Lv 1 3 pts. 11,388
  8. Avatar for Vinara 78. Vinara Lv 1 3 pts. 11,374
  9. Avatar for Jpilkington 79. Jpilkington Lv 1 2 pts. 11,358
  10. Avatar for alwen 80. alwen Lv 1 2 pts. 11,338

Comments