Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,819
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 12,616
  3. Avatar for Go Science 3. Go Science 56 pts. 12,455
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 12,450
  5. Avatar for Contenders 5. Contenders 29 pts. 12,422
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 12,400
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,090
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,962
  9. Avatar for Team China 9. Team China 6 pts. 11,785
  10. Avatar for Void Crushers 10. Void Crushers 4 pts. 11,774

  1. Avatar for heather-1 81. heather-1 Lv 1 2 pts. 11,331
  2. Avatar for rezaefar 82. rezaefar Lv 1 2 pts. 11,297
  3. Avatar for zo3xiaJonWeinberg 83. zo3xiaJonWeinberg Lv 1 2 pts. 11,285
  4. Avatar for pfirth 84. pfirth Lv 1 2 pts. 11,221
  5. Avatar for ShadowTactics 85. ShadowTactics Lv 1 2 pts. 11,196
  6. Avatar for Lotus23 86. Lotus23 Lv 1 2 pts. 11,190
  7. Avatar for Beany 87. Beany Lv 1 2 pts. 11,183
  8. Avatar for harvardman 88. harvardman Lv 1 1 pt. 11,181
  9. Avatar for GOAT_STJ 89. GOAT_STJ Lv 1 1 pt. 11,179
  10. Avatar for rinze 90. rinze Lv 1 1 pt. 11,158

Comments