Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,832
  2. Avatar for Team China 12. Team China 2 pts. 10,682
  3. Avatar for Russian team 13. Russian team 1 pt. 10,615
  4. Avatar for Australia 14. Australia 1 pt. 10,588
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 10,458
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,172
  7. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,875
  8. Avatar for Trinity Biology 20. Trinity Biology 1 pt. 8,611

  1. Avatar for victoriacarvalho 121. victoriacarvalho Lv 1 1 pt. 9,886
  2. Avatar for joshreback 122. joshreback Lv 1 1 pt. 9,885
  3. Avatar for Tlaloc 123. Tlaloc Lv 1 1 pt. 9,875
  4. Avatar for lexihodgden 124. lexihodgden Lv 1 1 pt. 9,854
  5. Avatar for Czim 125. Czim Lv 1 1 pt. 9,847
  6. Avatar for harvardman 126. harvardman Lv 1 1 pt. 9,840
  7. Avatar for illex 127. illex Lv 1 1 pt. 9,839
  8. Avatar for pfirth 128. pfirth Lv 1 1 pt. 9,795
  9. Avatar for roman madala 129. roman madala Lv 1 1 pt. 9,794
  10. Avatar for Jenot96 130. Jenot96 Lv 1 1 pt. 9,784

Comments