Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,832
  2. Avatar for Team China 12. Team China 2 pts. 10,682
  3. Avatar for Russian team 13. Russian team 1 pt. 10,615
  4. Avatar for Australia 14. Australia 1 pt. 10,588
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 10,458
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,172
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 10,042
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,875
  9. Avatar for CHEM 102 Protein Folding Lab 19. CHEM 102 Protein Folding Lab 1 pt. 9,854
  10. Avatar for Trinity Biology 20. Trinity Biology 1 pt. 8,611
  1. Avatar for OWM3 21. OWM3 Lv 1 50 pts. 11,475
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 49 pts. 11,468
  3. Avatar for johnmitch 23. johnmitch Lv 1 47 pts. 11,449
  4. Avatar for frood66 24. frood66 Lv 1 45 pts. 11,432
  5. Avatar for Lotus23 25. Lotus23 Lv 1 43 pts. 11,430
  6. Avatar for ucad 26. ucad Lv 1 42 pts. 11,426
  7. Avatar for Galaxie 27. Galaxie Lv 1 40 pts. 11,413
  8. Avatar for infjamc 28. infjamc Lv 1 39 pts. 11,391
  9. Avatar for maithra 29. maithra Lv 1 37 pts. 11,385
  10. Avatar for jobo0502 30. jobo0502 Lv 1 36 pts. 11,371

Comments