Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,832
  2. Avatar for Team China 12. Team China 2 pts. 10,682
  3. Avatar for Russian team 13. Russian team 1 pt. 10,615
  4. Avatar for Australia 14. Australia 1 pt. 10,588
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 10,458
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,172
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 10,042
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,875
  9. Avatar for CHEM 102 Protein Folding Lab 19. CHEM 102 Protein Folding Lab 1 pt. 9,854
  10. Avatar for Trinity Biology 20. Trinity Biology 1 pt. 8,611
  1. Avatar for Norrjane 31. Norrjane Lv 1 34 pts. 11,363
  2. Avatar for blazegeek 32. blazegeek Lv 1 33 pts. 11,358
  3. Avatar for mtnuc 33. mtnuc Lv 1 32 pts. 11,345
  4. Avatar for akaaka 34. akaaka Lv 1 30 pts. 11,340
  5. Avatar for Evica 35. Evica Lv 1 29 pts. 11,332
  6. Avatar for hada 36. hada Lv 1 28 pts. 11,331
  7. Avatar for christioanchauvin 37. christioanchauvin Lv 1 27 pts. 11,323
  8. Avatar for ProfVince 38. ProfVince Lv 1 26 pts. 11,320
  9. Avatar for manu8170 39. manu8170 Lv 1 25 pts. 11,318
  10. Avatar for xythus 40. xythus Lv 1 24 pts. 11,296

Comments