Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,832
  2. Avatar for Team China 12. Team China 2 pts. 10,682
  3. Avatar for Russian team 13. Russian team 1 pt. 10,615
  4. Avatar for Australia 14. Australia 1 pt. 10,588
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 10,458
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,172
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 10,042
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,875
  9. Avatar for CHEM 102 Protein Folding Lab 19. CHEM 102 Protein Folding Lab 1 pt. 9,854
  10. Avatar for Trinity Biology 20. Trinity Biology 1 pt. 8,611
  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 23 pts. 11,291
  2. Avatar for maxsteinbok 42. maxsteinbok Lv 1 22 pts. 11,289
  3. Avatar for aznarog 43. aznarog Lv 1 21 pts. 11,244
  4. Avatar for kyoota 44. kyoota Lv 1 20 pts. 11,235
  5. Avatar for cjddig 45. cjddig Lv 1 19 pts. 11,202
  6. Avatar for Altercomp 46. Altercomp Lv 1 18 pts. 11,190
  7. Avatar for Pazithi 47. Pazithi Lv 1 17 pts. 11,190
  8. Avatar for PeterDav 48. PeterDav Lv 1 17 pts. 11,084
  9. Avatar for alcor29 49. alcor29 Lv 1 16 pts. 11,076
  10. Avatar for NeLikomSheet 50. NeLikomSheet Lv 1 15 pts. 11,064

Comments