Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,832
  2. Avatar for Team China 12. Team China 2 pts. 10,682
  3. Avatar for Russian team 13. Russian team 1 pt. 10,615
  4. Avatar for Australia 14. Australia 1 pt. 10,588
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 10,458
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,172
  7. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,875
  8. Avatar for Trinity Biology 20. Trinity Biology 1 pt. 8,611

  1. Avatar for AeonFluff 51. AeonFluff Lv 1 15 pts. 11,063
  2. Avatar for Trajan464 52. Trajan464 Lv 1 14 pts. 11,049
  3. Avatar for vuvuvu 53. vuvuvu Lv 1 13 pts. 11,019
  4. Avatar for Pawel Tluscik 54. Pawel Tluscik Lv 1 13 pts. 11,011
  5. Avatar for martinzblavy 55. martinzblavy Lv 1 12 pts. 10,989
  6. Avatar for Deleted player 56. Deleted player 11 pts. 10,979
  7. Avatar for Blipperman 57. Blipperman Lv 1 11 pts. 10,962
  8. Avatar for bx7gn 58. bx7gn Lv 1 10 pts. 10,946
  9. Avatar for WBarme1234 59. WBarme1234 Lv 1 10 pts. 10,933
  10. Avatar for Vincera 60. Vincera Lv 1 9 pts. 10,925

Comments