Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,832
  2. Avatar for Team China 12. Team China 2 pts. 10,682
  3. Avatar for Russian team 13. Russian team 1 pt. 10,615
  4. Avatar for Australia 14. Australia 1 pt. 10,588
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 10,458
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,172
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 10,042
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,875
  9. Avatar for CHEM 102 Protein Folding Lab 19. CHEM 102 Protein Folding Lab 1 pt. 9,854
  10. Avatar for Trinity Biology 20. Trinity Biology 1 pt. 8,611
  1. Avatar for ShadowTactics 61. ShadowTactics Lv 1 9 pts. 10,903
  2. Avatar for ManVsYard 62. ManVsYard Lv 1 9 pts. 10,863
  3. Avatar for Alistair69 63. Alistair69 Lv 1 8 pts. 10,863
  4. Avatar for fishercat 64. fishercat Lv 1 8 pts. 10,847
  5. Avatar for heather-1 65. heather-1 Lv 1 7 pts. 10,845
  6. Avatar for borattt 66. borattt Lv 1 7 pts. 10,843
  7. Avatar for Dr.Sillem 67. Dr.Sillem Lv 1 7 pts. 10,833
  8. Avatar for vybi 68. vybi Lv 1 6 pts. 10,832
  9. Avatar for Oransche 69. Oransche Lv 1 6 pts. 10,825
  10. Avatar for rezaefar 70. rezaefar Lv 1 6 pts. 10,788

Comments