Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since about 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Contenders 100 pts. 11,717
  2. Avatar for Go Science 2. Go Science 77 pts. 11,700
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,691
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 11,655
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 11,562
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 11,551
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 11 pts. 11,019
  9. Avatar for Olsztynek 9. Olsztynek 7 pts. 11,011
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,903

  1. Avatar for BarrySampson 71. BarrySampson Lv 1 5 pts. 10,784
  2. Avatar for pauldunn 72. pauldunn Lv 1 5 pts. 10,782
  3. Avatar for fpc 73. fpc Lv 1 5 pts. 10,774
  4. Avatar for Arne Heessels 74. Arne Heessels Lv 1 5 pts. 10,772
  5. Avatar for sciencewalker 75. sciencewalker Lv 1 4 pts. 10,691
  6. Avatar for REDing 76. REDing Lv 1 4 pts. 10,682
  7. Avatar for multaq 77. multaq Lv 1 4 pts. 10,671
  8. Avatar for jamiexq 78. jamiexq Lv 1 4 pts. 10,635
  9. Avatar for NPrincipi 79. NPrincipi Lv 1 3 pts. 10,625
  10. Avatar for ComputerMage 80. ComputerMage Lv 1 3 pts. 10,615

Comments