Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Contenders 100 pts. 11,717
  2. Avatar for Go Science 2. Go Science 77 pts. 11,700
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,691
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 11,655
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 11,562
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 11,551
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 11 pts. 11,019
  9. Avatar for Olsztynek 9. Olsztynek 7 pts. 11,011
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,903

  1. Avatar for Sleepnot 112. Sleepnot Lv 1 1 pt. 10,115
  2. Avatar for kitsoune 113. kitsoune Lv 1 1 pt. 10,075
  3. Avatar for vinsi 114. vinsi Lv 1 1 pt. 10,057
  4. Avatar for Jpilkington 115. Jpilkington Lv 1 1 pt. 10,049
  5. Avatar for Djinn13 116. Djinn13 Lv 1 1 pt. 10,042
  6. Avatar for furi0us 117. furi0us Lv 1 1 pt. 10,009
  7. Avatar for DScott 118. DScott Lv 1 1 pt. 9,989
  8. Avatar for susbus 119. susbus Lv 1 1 pt. 9,969
  9. Avatar for bezmusk 120. bezmusk Lv 1 1 pt. 9,954

Comments