Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,225
  2. Avatar for Manthan - DRILS 12. Manthan - DRILS 1 pt. 10,115
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 10,111
  4. Avatar for NMHU Cell and Molecular Biology 14. NMHU Cell and Molecular Biology 1 pt. 6,927
  5. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 6,734
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,437
  7. Avatar for CHE222_2021 1 17. CHE222_2021 1 1 pt. 4,359
  1. Avatar for bitloin 121. bitloin Lv 1 1 pt. 6,712
  2. Avatar for mariya_gladysheva_104 122. mariya_gladysheva_104 Lv 1 1 pt. 6,709
  3. Avatar for hyunjoo 123. hyunjoo Lv 1 1 pt. 6,645
  4. Avatar for Yuxin Ren 124. Yuxin Ren Lv 1 1 pt. 6,615
  5. Avatar for 61962119 125. 61962119 Lv 1 1 pt. 6,563
  6. Avatar for goldpilot22 126. goldpilot22 Lv 1 1 pt. 6,543
  7. Avatar for MrZanav 127. MrZanav Lv 1 1 pt. 6,488
  8. Avatar for MVP FoldIt Champ123 128. MVP FoldIt Champ123 Lv 1 1 pt. 6,477
  9. Avatar for BC5ML 129. BC5ML Lv 1 1 pt. 6,470
  10. Avatar for Amogh_16 130. Amogh_16 Lv 1 1 pt. 6,463

Comments