Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,219
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 11,141
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 11,113
  4. Avatar for Contenders 4. Contenders 36 pts. 11,080
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 11,053
  6. Avatar for Go Science 6. Go Science 16 pts. 11,038
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 10,928
  8. Avatar for Czech National Team 8. Czech National Team 6 pts. 10,701
  9. Avatar for Team China 9. Team China 4 pts. 10,425
  10. Avatar for Australia 10. Australia 2 pts. 10,278
  1. Avatar for bitloin 121. bitloin Lv 1 1 pt. 6,712
  2. Avatar for mariya_gladysheva_104 122. mariya_gladysheva_104 Lv 1 1 pt. 6,709
  3. Avatar for hyunjoo 123. hyunjoo Lv 1 1 pt. 6,645
  4. Avatar for Yuxin Ren 124. Yuxin Ren Lv 1 1 pt. 6,615
  5. Avatar for 61962119 125. 61962119 Lv 1 1 pt. 6,563
  6. Avatar for goldpilot22 126. goldpilot22 Lv 1 1 pt. 6,543
  7. Avatar for MrZanav 127. MrZanav Lv 1 1 pt. 6,488
  8. Avatar for MVP FoldIt Champ123 128. MVP FoldIt Champ123 Lv 1 1 pt. 6,477
  9. Avatar for BC5ML 129. BC5ML Lv 1 1 pt. 6,470
  10. Avatar for Amogh_16 130. Amogh_16 Lv 1 1 pt. 6,463

Comments