Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,219
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 11,141
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 11,113
  4. Avatar for Contenders 4. Contenders 36 pts. 11,080
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 11,053
  6. Avatar for Go Science 6. Go Science 16 pts. 11,038
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 10,928
  8. Avatar for Czech National Team 8. Czech National Team 6 pts. 10,701
  9. Avatar for Team China 9. Team China 4 pts. 10,425
  10. Avatar for Australia 10. Australia 2 pts. 10,278
  1. Avatar for NotJim99 111. NotJim99 Lv 1 1 pt. 7,224
  2. Avatar for zim57 112. zim57 Lv 1 1 pt. 7,117
  3. Avatar for heather-1 113. heather-1 Lv 1 1 pt. 7,053
  4. Avatar for Aubrey_Elder 114. Aubrey_Elder Lv 1 1 pt. 7,008
  5. Avatar for tferrari 115. tferrari Lv 1 1 pt. 6,927
  6. Avatar for knarzelwicht 116. knarzelwicht Lv 1 1 pt. 6,815
  7. Avatar for soph_v13 117. soph_v13 Lv 1 1 pt. 6,788
  8. Avatar for acspencer 118. acspencer Lv 1 1 pt. 6,776
  9. Avatar for chillfold 119. chillfold Lv 1 1 pt. 6,749
  10. Avatar for Churbanova Mariya 120. Churbanova Mariya Lv 1 1 pt. 6,734

Comments