Placeholder image of a protein
Icon representing a puzzle

1993: Revisiting Puzzle 64: Thioredoxin

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
May 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 11,295
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,177
  3. Avatar for Team China 13. Team China 1 pt. 11,093
  4. Avatar for Australia 14. Australia 1 pt. 10,889
  5. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 10,847
  6. Avatar for https://fold.it/portal/Chem445_2021 16. https://fold.it/portal/Chem445_2021 1 pt. 10,829
  7. Avatar for QCNMIT 17. QCNMIT 1 pt. 10,194
  8. Avatar for Ivy Tech CHEM 115 18. Ivy Tech CHEM 115 1 pt. 9,903
  1. Avatar for ManVsYard 91. ManVsYard Lv 1 2 pts. 11,042
  2. Avatar for Arne Heessels 92. Arne Heessels Lv 1 2 pts. 11,041
  3. Avatar for hada 93. hada Lv 1 2 pts. 11,038
  4. Avatar for Altercomp 94. Altercomp Lv 1 2 pts. 11,030
  5. Avatar for Beany 95. Beany Lv 1 2 pts. 11,009
  6. Avatar for Squirrely 96. Squirrely Lv 1 2 pts. 10,987
  7. Avatar for Matroch 97. Matroch Lv 1 1 pt. 10,976
  8. Avatar for ivalnic 98. ivalnic Lv 1 1 pt. 10,972
  9. Avatar for Mohoernchen 99. Mohoernchen Lv 1 1 pt. 10,959
  10. Avatar for DScott 100. DScott Lv 1 1 pt. 10,950

Comments