Placeholder image of a protein
Icon representing a puzzle

1993: Revisiting Puzzle 64: Thioredoxin

Closed since almost 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 11,805
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,794
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,783
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,702
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,692
  6. Avatar for Contenders 6. Contenders 18 pts. 11,626
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,602
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 11,536
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 11,442
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 11,400

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 11,805
  2. Avatar for Galaxie 2. Galaxie Lv 1 97 pts. 11,794
  3. Avatar for LociOiling 3. LociOiling Lv 1 94 pts. 11,783
  4. Avatar for guineapig 4. guineapig Lv 1 91 pts. 11,742
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 88 pts. 11,737
  6. Avatar for robgee 6. robgee Lv 1 86 pts. 11,692
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 83 pts. 11,692
  8. Avatar for johnmitch 8. johnmitch Lv 1 80 pts. 11,688
  9. Avatar for frood66 9. frood66 Lv 1 78 pts. 11,684
  10. Avatar for nicobul 10. nicobul Lv 1 75 pts. 11,681

Comments