Placeholder image of a protein
Icon representing a puzzle

1993: Revisiting Puzzle 64: Thioredoxin

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
May 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 11,295
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,177
  3. Avatar for Team China 13. Team China 1 pt. 11,093
  4. Avatar for Australia 14. Australia 1 pt. 10,889
  5. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 10,847
  6. Avatar for QCNMIT 17. QCNMIT 1 pt. 10,194
  7. Avatar for Ivy Tech CHEM 115 18. Ivy Tech CHEM 115 1 pt. 9,903

  1. Avatar for pascal ochem 101. pascal ochem Lv 1 1 pt. 10,940
  2. Avatar for cheesecake1408 102. cheesecake1408 Lv 1 1 pt. 10,923
  3. Avatar for Maerlyn138 103. Maerlyn138 Lv 1 1 pt. 10,919
  4. Avatar for Spicychacha 104. Spicychacha Lv 1 1 pt. 10,916
  5. Avatar for Dr.Sillem 105. Dr.Sillem Lv 1 1 pt. 10,911
  6. Avatar for dianaz98 106. dianaz98 Lv 1 1 pt. 10,907
  7. Avatar for rinze 107. rinze Lv 1 1 pt. 10,907
  8. Avatar for AlkiP0Ps 108. AlkiP0Ps Lv 1 1 pt. 10,889
  9. Avatar for Larini 109. Larini Lv 1 1 pt. 10,871
  10. Avatar for martinf 110. martinf Lv 1 1 pt. 10,859

Comments