Placeholder image of a protein
Icon representing a puzzle

1993: Revisiting Puzzle 64: Thioredoxin

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
May 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 11,295
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,177
  3. Avatar for Team China 13. Team China 1 pt. 11,093
  4. Avatar for Australia 14. Australia 1 pt. 10,889
  5. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 10,847
  6. Avatar for QCNMIT 17. QCNMIT 1 pt. 10,194
  7. Avatar for Ivy Tech CHEM 115 18. Ivy Tech CHEM 115 1 pt. 9,903

  1. Avatar for Evica 71. Evica Lv 1 6 pts. 11,274
  2. Avatar for 0xdecade 72. 0xdecade Lv 1 6 pts. 11,257
  3. Avatar for bamh 73. bamh Lv 1 5 pts. 11,255
  4. Avatar for infjamc 74. infjamc Lv 1 5 pts. 11,243
  5. Avatar for cjddig 75. cjddig Lv 1 5 pts. 11,242
  6. Avatar for Karlheinz 76. Karlheinz Lv 1 5 pts. 11,237
  7. Avatar for argyrw 77. argyrw Lv 1 4 pts. 11,226
  8. Avatar for Trajan464 78. Trajan464 Lv 1 4 pts. 11,221
  9. Avatar for jsfoldingaccount 79. jsfoldingaccount Lv 1 4 pts. 11,220
  10. Avatar for AeonFluff 80. AeonFluff Lv 1 4 pts. 11,203

Comments