Placeholder image of a protein
Icon representing a puzzle

1993: Revisiting Puzzle 64: Thioredoxin

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
May 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,805
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,794
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,783
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,702
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,692
  6. Avatar for Contenders 6. Contenders 18 pts. 11,626
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,602
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 11,536
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 11,442
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 11,400
  1. Avatar for aldo.guzman 141. aldo.guzman Lv 1 1 pt. 10,194
  2. Avatar for no_7knight 142. no_7knight Lv 1 1 pt. 9,947
  3. Avatar for ronigurvich 143. ronigurvich Lv 1 1 pt. 9,937
  4. Avatar for elchambers45 144. elchambers45 Lv 1 1 pt. 9,903
  5. Avatar for ksacta 145. ksacta Lv 1 1 pt. 9,897
  6. Avatar for CRELOXP 146. CRELOXP Lv 1 1 pt. 9,753
  7. Avatar for Azazellomememenya 147. Azazellomememenya Lv 1 1 pt. 9,215
  8. Avatar for Artoria2e5 148. Artoria2e5 Lv 1 1 pt. 9,072
  9. Avatar for harvardman 149. harvardman Lv 1 1 pt. 8,790
  10. Avatar for mwm64 150. mwm64 Lv 1 1 pt. 8,775

Comments