Placeholder image of a protein
Icon representing a puzzle

1993: Revisiting Puzzle 64: Thioredoxin

Closed since about 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 11,805
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,794
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,783
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,702
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,692
  6. Avatar for Contenders 6. Contenders 18 pts. 11,626
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,602
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 11,536
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 11,442
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 11,400

  1. Avatar for zannipietro 81. zannipietro Lv 1 3 pts. 11,188
  2. Avatar for ShadowTactics 82. ShadowTactics Lv 1 3 pts. 11,177
  3. Avatar for xythus 83. xythus Lv 1 3 pts. 11,174
  4. Avatar for alcor29 84. alcor29 Lv 1 3 pts. 11,109
  5. Avatar for Vinara 85. Vinara Lv 1 3 pts. 11,109
  6. Avatar for zo3xiaJonWeinberg 86. zo3xiaJonWeinberg Lv 1 3 pts. 11,093
  7. Avatar for Hellcat6 87. Hellcat6 Lv 1 2 pts. 11,080
  8. Avatar for Simek 88. Simek Lv 1 2 pts. 11,058
  9. Avatar for johnpwykes 89. johnpwykes Lv 1 2 pts. 11,054
  10. Avatar for dahast.de 90. dahast.de Lv 1 2 pts. 11,047

Comments