Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 9,969
  2. Avatar for Void Crushers 12. Void Crushers 2 pts. 9,966
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,622
  4. Avatar for Australia 14. Australia 1 pt. 9,542
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,512
  6. Avatar for Team China 16. Team China 1 pt. 9,501
  7. Avatar for Window Group 17. Window Group 1 pt. 3,439
  8. Avatar for BIOB101 - Discover Biology 18. BIOB101 - Discover Biology 1 pt. 3,092
  9. Avatar for incognito group 19. incognito group 1 pt. 2,966
  10. Avatar for Foldit Staff 20. Foldit Staff 1 pt. 2,966
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 10,529
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 10,503
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 94 pts. 10,456
  4. Avatar for mirp 4. mirp Lv 1 90 pts. 10,441
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 87 pts. 10,426
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 84 pts. 10,411
  7. Avatar for Phyx 7. Phyx Lv 1 81 pts. 10,406
  8. Avatar for johnmitch 8. johnmitch Lv 1 78 pts. 10,403
  9. Avatar for Deleted player 9. Deleted player 75 pts. 10,385
  10. Avatar for Galaxie 10. Galaxie Lv 1 72 pts. 10,378

Comments