2004: Revisiting Puzzle 67: Integrase
Closed since over 4 years ago
Novice Overall PredictionSummary
- Created
- June 10, 2021
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD