2004: Revisiting Puzzle 67: Integrase

Closed since over 4 years ago

Summary

• Created: June 10, 2021
• Expires: June 17, 2021 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

• 1. Anthropic Dreams 100 pts. 10,529
• 2. Beta Folders 77 pts. 10,503
• 3. Contenders 58 pts. 10,456
• 4. Go Science 43 pts. 10,441
• 5. Marvin's bunch 31 pts. 10,373
• 6. L'Alliance Francophone 22 pts. 10,335
• 7. Gargleblasters 15 pts. 10,330
• 8. Czech National Team 11 pts. 10,136
• 9. METU-BIN 7 pts. 10,078
• 10. BOINC@Poland 5 pts. 10,072

Top soloists

• 1. grogar7 100 pts. 10,529
• 2. LociOiling 97 pts. 10,503
• 3. Bletchley Park 94 pts. 10,456
• 4. mirp 90 pts. 10,441
• 5. NinjaGreg 87 pts. 10,426
• 6. Bruno Kestemont 84 pts. 10,411
• 7. Phyx 81 pts. 10,406
• 8. johnmitch 78 pts. 10,403
• 9. Deleted player 75 pts. 10,385
• 10. Galaxie 72 pts. 10,378