2004: Revisiting Puzzle 67: Integrase

Closed since over 4 years ago

Summary

• Created: June 10, 2021
• Expires: June 17, 2021 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

• 1. Anthropic Dreams 100 pts. 10,529
• 2. Beta Folders 77 pts. 10,503
• 3. Contenders 58 pts. 10,456
• 4. Go Science 43 pts. 10,441
• 5. Marvin's bunch 31 pts. 10,373
• 6. L'Alliance Francophone 22 pts. 10,335
• 7. Gargleblasters 15 pts. 10,330
• 8. Czech National Team 11 pts. 10,136
• 9. METU-BIN 7 pts. 10,078
• 10. BOINC@Poland 5 pts. 10,072

Top evolvers

• 1. Galaxie 100 pts. 10,518
• 2. LociOiling 74 pts. 10,503
• 3. Deleted player 54 pts. 10,501
• 4. robgee 38 pts. 10,439
• 5. toshiue 27 pts. 10,436
• 6. mirp 18 pts. 10,428
• 7. Bruno Kestemont 12 pts. 10,421
• 8. borattt 8 pts. 10,419
• 9. silent gene 5 pts. 10,419
• 10. kyoota 3 pts. 10,414