Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,529
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,503
  3. Avatar for Contenders 3. Contenders 58 pts. 10,456
  4. Avatar for Go Science 4. Go Science 43 pts. 10,441
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,373
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,335
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,330
  8. Avatar for Czech National Team 8. Czech National Team 11 pts. 10,136
  9. Avatar for METU-BIN 9. METU-BIN 7 pts. 10,078
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,072

  1. Avatar for origamiti 121. origamiti Lv 1 1 pt. 9,116
  2. Avatar for DarkAdrianus 122. DarkAdrianus Lv 1 1 pt. 9,083
  3. Avatar for argyrw 123. argyrw Lv 1 1 pt. 9,045
  4. Avatar for furi0us 124. furi0us Lv 1 1 pt. 9,024
  5. Avatar for qucker135 125. qucker135 Lv 1 1 pt. 9,007
  6. Avatar for Sakai Izumi 126. Sakai Izumi Lv 1 1 pt. 8,990
  7. Avatar for astoneman 127. astoneman Lv 1 1 pt. 8,890
  8. Avatar for Crossed Sticks 128. Crossed Sticks Lv 1 1 pt. 8,624
  9. Avatar for drumpeter18yrs9yrs 129. drumpeter18yrs9yrs Lv 1 1 pt. 8,440
  10. Avatar for e253503 130. e253503 Lv 1 1 pt. 8,202

Comments