Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 10,094
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 9,878
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,587
  4. Avatar for Texas Tech Red Folders 14. Texas Tech Red Folders 1 pt. 8,822
  5. Avatar for Window Group 15. Window Group 1 pt. 6,417
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 4,858
  1. Avatar for furi0us 131. furi0us Lv 1 1 pt. 4,858
  2. Avatar for bkoep 132. bkoep Lv 1 1 pt. 4,858
  3. Avatar for rmoretti 133. rmoretti Lv 1 1 pt. 4,858

Comments