Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 10,094
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 9,878
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,587
  4. Avatar for Texas Tech Red Folders 14. Texas Tech Red Folders 1 pt. 8,822
  5. Avatar for Window Group 15. Window Group 1 pt. 6,417
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 4,858
  1. Avatar for WBarme1234 31. WBarme1234 Lv 1 28 pts. 10,433
  2. Avatar for O Seki To 32. O Seki To Lv 1 27 pts. 10,432
  3. Avatar for NPrincipi 33. NPrincipi Lv 1 25 pts. 10,407
  4. Avatar for drumpeter18yrs9yrs 34. drumpeter18yrs9yrs Lv 1 24 pts. 10,404
  5. Avatar for fishercat 35. fishercat Lv 1 23 pts. 10,394
  6. Avatar for akaaka 36. akaaka Lv 1 22 pts. 10,375
  7. Avatar for Lotus23 37. Lotus23 Lv 1 21 pts. 10,354
  8. Avatar for phi16 38. phi16 Lv 1 20 pts. 10,315
  9. Avatar for silent gene 39. silent gene Lv 1 19 pts. 10,314
  10. Avatar for ShadowTactics 40. ShadowTactics Lv 1 18 pts. 10,307

Comments