Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 10,094
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 9,878
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,587
  4. Avatar for Texas Tech Red Folders 14. Texas Tech Red Folders 1 pt. 8,822
  5. Avatar for Window Group 15. Window Group 1 pt. 6,417
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 4,858
  1. Avatar for BerkayGunay 61. BerkayGunay Lv 1 5 pts. 10,094
  2. Avatar for infjamc 62. infjamc Lv 1 5 pts. 10,082
  3. Avatar for Zosa 63. Zosa Lv 1 5 pts. 10,075
  4. Avatar for fpc 64. fpc Lv 1 4 pts. 10,072
  5. Avatar for OWM3 65. OWM3 Lv 1 4 pts. 10,041
  6. Avatar for PeterDav 66. PeterDav Lv 1 4 pts. 10,036
  7. Avatar for Altercomp 67. Altercomp Lv 1 4 pts. 9,996
  8. Avatar for heather-1 68. heather-1 Lv 1 3 pts. 9,996
  9. Avatar for xythus 69. xythus Lv 1 3 pts. 9,991
  10. Avatar for Trajan464 70. Trajan464 Lv 1 3 pts. 9,967

Comments