Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 10,094
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 9,878
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,587
  4. Avatar for Texas Tech Red Folders 14. Texas Tech Red Folders 1 pt. 8,822
  5. Avatar for Window Group 15. Window Group 1 pt. 6,417
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 4,858
  1. Avatar for papaonn 71. papaonn Lv 1 3 pts. 9,936
  2. Avatar for equilibria 72. equilibria Lv 1 3 pts. 9,916
  3. Avatar for Wiz kid 73. Wiz kid Lv 1 2 pts. 9,915
  4. Avatar for vybi 74. vybi Lv 1 2 pts. 9,878
  5. Avatar for AlkiP0Ps 75. AlkiP0Ps Lv 1 2 pts. 9,864
  6. Avatar for abiogenesis 76. abiogenesis Lv 1 2 pts. 9,822
  7. Avatar for kyoota 77. kyoota Lv 1 2 pts. 9,809
  8. Avatar for pfirth 78. pfirth Lv 1 2 pts. 9,808
  9. Avatar for rezaefar 79. rezaefar Lv 1 2 pts. 9,782
  10. Avatar for Oransche 80. Oransche Lv 1 2 pts. 9,775

Comments