Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,737
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,717
  3. Avatar for Contenders 3. Contenders 49 pts. 10,706
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,621
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,610
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,573
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,564
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,449
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 10,432
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,307
  1. Avatar for roman madala 91. roman madala Lv 1 1 pt. 9,579
  2. Avatar for cjddig 92. cjddig Lv 1 1 pt. 9,576
  3. Avatar for Squirrely 93. Squirrely Lv 1 1 pt. 9,558
  4. Avatar for rabamino12358 94. rabamino12358 Lv 1 1 pt. 9,521
  5. Avatar for Beany 95. Beany Lv 1 1 pt. 9,520
  6. Avatar for Todd6485577 96. Todd6485577 Lv 1 1 pt. 9,515
  7. Avatar for DScott 97. DScott Lv 1 1 pt. 9,467
  8. Avatar for rinze 98. rinze Lv 1 1 pt. 9,391
  9. Avatar for Mohoernchen 99. Mohoernchen Lv 1 1 pt. 9,370
  10. Avatar for jawz101 100. jawz101 Lv 1 1 pt. 9,367

Comments