Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,737
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,717
  3. Avatar for Contenders 3. Contenders 49 pts. 10,706
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,621
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,610
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,573
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,564
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,449
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 10,432
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,307
  1. Avatar for CAN1958 111. CAN1958 Lv 1 1 pt. 9,054
  2. Avatar for sgaray 112. sgaray Lv 1 1 pt. 8,938
  3. Avatar for Sarah Coppens 113. Sarah Coppens Lv 1 1 pt. 8,856
  4. Avatar for Clunkydunky 114. Clunkydunky Lv 1 1 pt. 8,839
  5. Avatar for krosika1 115. krosika1 Lv 1 1 pt. 8,822
  6. Avatar for kyber4353 116. kyber4353 Lv 1 1 pt. 8,818
  7. Avatar for incognito genie 117. incognito genie Lv 1 1 pt. 8,158
  8. Avatar for kingakubatata 118. kingakubatata Lv 1 1 pt. 8,143
  9. Avatar for Rutecasso 119. Rutecasso Lv 1 1 pt. 8,130
  10. Avatar for Reactive 120. Reactive Lv 1 1 pt. 7,219

Comments