Placeholder image of a protein
Icon representing a puzzle

2013: Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
July 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 9,488
  2. Avatar for SARE/BRBT 2021 12. SARE/BRBT 2021 1 pt. 9,356
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,334
  4. Avatar for Team China 14. Team China 1 pt. 9,020
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,883
  6. Avatar for Spain Team 16. Spain Team 1 pt. 8,439
  7. Avatar for Window Group 17. Window Group 1 pt. 6,212

  1. Avatar for Maerlyn138 41. Maerlyn138 Lv 1 18 pts. 10,228
  2. Avatar for alcor29 42. alcor29 Lv 1 17 pts. 10,228
  3. Avatar for manu8170 43. manu8170 Lv 1 17 pts. 10,169
  4. Avatar for Vincera 44. Vincera Lv 1 16 pts. 10,140
  5. Avatar for NPrincipi 45. NPrincipi Lv 1 15 pts. 10,129
  6. Avatar for Threeoak 46. Threeoak Lv 1 14 pts. 10,122
  7. Avatar for cjddig 47. cjddig Lv 1 13 pts. 10,112
  8. Avatar for fpc 48. fpc Lv 1 13 pts. 10,100
  9. Avatar for abiogenesis 49. abiogenesis Lv 1 12 pts. 9,941
  10. Avatar for Hellcat6 50. Hellcat6 Lv 1 11 pts. 9,906

Comments


Vincera Lv 1

Greetings, All.
Need some guidance on P2013: How do I know which Bridge Wiggle format to select since the Description denotes a Revisit of P69 but references P55;
AND
P1961 revisits P57 but is based on P55;
AND
P1532 is based on P69;
AND
P1077 is based on P69.

  • all with varying BWs.

LociOiling Lv 1

We've had a few of these scorpion toxins, with different configurations.

The unofficial cheat sheet for this is: https://foldit.fandom.com/wiki/Revisiting_puzzle/69:_Scorpion_Toxin

The bridges for this puzzle in Bridge Wiggle format are:

17,43 28,48 32,50 44,70

Your mileage may vary; some have had success with different bridge configurations on some of these puzzles. Also, for me, Bridge Wiggle has been less successful at wiggling recently. The banding feature can still be helpful. In some cases, I've been able to band, then form bridges by dragging the cysteines closer.

Vincera Lv 1

Thanx ever so much, Loci. I commenced with this same Hottentotta format but may not end with it. I did retain your Fandom notes from the Beta-Neurotoxin puzzle that you helped me with in February past. Much appreciation!