Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,021
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,922
  3. Avatar for SARE/BRBT 2021 13. SARE/BRBT 2021 1 pt. 9,592
  4. Avatar for test_group1 14. test_group1 1 pt. 3,796
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 3,796
  1. Avatar for drumpeter18yrs9yrs 91. drumpeter18yrs9yrs Lv 1 1 pt. 9,897
  2. Avatar for cjddig 92. cjddig Lv 1 1 pt. 9,896
  3. Avatar for Mohoernchen 93. Mohoernchen Lv 1 1 pt. 9,844
  4. Avatar for qwertysaccount 94. qwertysaccount Lv 1 1 pt. 9,832
  5. Avatar for pascal ochem 95. pascal ochem Lv 1 1 pt. 9,828
  6. Avatar for CharaLilith 96. CharaLilith Lv 1 1 pt. 9,779
  7. Avatar for rinze 97. rinze Lv 1 1 pt. 9,772
  8. Avatar for kitsoune 98. kitsoune Lv 1 1 pt. 9,733
  9. Avatar for jawz101 99. jawz101 Lv 1 1 pt. 9,678
  10. Avatar for RyeSnake 100. RyeSnake Lv 1 1 pt. 9,677

Comments