Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,021
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,922
  3. Avatar for SARE/BRBT 2021 13. SARE/BRBT 2021 1 pt. 9,592
  4. Avatar for test_group1 14. test_group1 1 pt. 3,796
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 3,796
  1. Avatar for g_b 21. g_b Lv 1 43 pts. 10,689
  2. Avatar for neonrainbowtime 22. neonrainbowtime Lv 1 41 pts. 10,684
  3. Avatar for Galaxie 23. Galaxie Lv 1 39 pts. 10,653
  4. Avatar for NPrincipi 24. NPrincipi Lv 1 38 pts. 10,636
  5. Avatar for Phyx 25. Phyx Lv 1 36 pts. 10,634
  6. Avatar for Blipperman 26. Blipperman Lv 1 34 pts. 10,601
  7. Avatar for silent gene 27. silent gene Lv 1 33 pts. 10,584
  8. Avatar for OWM3 28. OWM3 Lv 1 31 pts. 10,581
  9. Avatar for jobo0502 29. jobo0502 Lv 1 30 pts. 10,547
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 28 pts. 10,527

Comments